PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010537507.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Cleomaceae; Tarenaya
Family MYB_related
Protein Properties Length: 388aa    MW: 42514.5 Da    PI: 8.3198
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010537507.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.85.2e-185094147
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47
                     r +WT+eE++++++avk++G g W+ I +++g ++t+ q++s+ qk+
   XP_010537507.1 50 REKWTEEEHQKFLEAVKLYGRG-WRQIEEHVG-TKTAVQIRSHAQKF 94
                     789*******************.*********.************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.61E-174499IPR009057Homeodomain-like
PROSITE profilePS5129422.4714599IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.7E-104796IPR009057Homeodomain-like
TIGRFAMsTIGR015571.4E-164897IPR006447Myb domain, plants
SMARTSM007178.5E-144997IPR001005SANT/Myb domain
PfamPF002499.9E-165093IPR001005SANT/Myb domain
CDDcd001675.16E-125295No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0046686Biological Processresponse to cadmium ion
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 388 aa     Download sequence    Send to blast
MAAPDHSEGF SNVESTNGGV HGGVNTEMGS QSGENILPKV RKPYTITKQR EKWTEEEHQK  60
FLEAVKLYGR GWRQIEEHVG TKTAVQIRSH AQKFFSKVAR ETDNVNDSPV KAIVIPPPRP  120
KRKPTHPYPR KMPVANQPDK TPSPTLSVTE KGNKSPTSVL SAFPSDNLED QLNGCSSPNS  180
CTTDTHNSSE KGNEYATSKS PLEDGKPPLL MKSDSSNHWS VSPQEDAATV VVPVASITLF  240
GKIVLVVDPN KPSSPRQETG LKNPCPNIKK HTLSIDSVDV ATDLSIGVSS YCQISTVNLY  300
TEERPRVKAG VPETSCTSSS APGSVTEEAG NWGKRAEPCR WVSSSEKSTC YHTTRGFRPY  360
KRCLSEREVT SPVVTSEEEE SRRARVCL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00146DAPTransfer from AT1G18330Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010537507.10.0PREDICTED: protein REVEILLE 7 isoform X1
SwissprotB3H5A83e-99RVE7_ARATH; Protein REVEILLE 7
TrEMBLD7KGC91e-103D7KGC9_ARALL; Early-phytochrome-responsive1
STRINGfgenesh2_kg.1__2004__AT1G18330.21e-102(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM91742738
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G18330.12e-83MYB_related family protein